Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2630130..2630768 | Replicon | chromosome |
| Accession | NZ_CP122719 | ||
| Organism | Escherichia coli strain ETEC1748 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
| Locus tag | QDW92_RS12985 | Protein ID | WP_063085535.1 |
| Coordinates | 2630592..2630768 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QDW92_RS12980 | Protein ID | WP_001270286.1 |
| Coordinates | 2630130..2630546 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW92_RS12955 (2625178) | 2625178..2625297 | - | 120 | Protein_2537 | ABC transporter permease | - |
| QDW92_RS12960 (2625270) | 2625270..2626223 | - | 954 | WP_242378934.1 | ABC transporter permease | - |
| QDW92_RS12965 (2626224) | 2626224..2627237 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
| QDW92_RS12970 (2627255) | 2627255..2628400 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
| QDW92_RS12975 (2628645) | 2628645..2630051 | - | 1407 | WP_063085536.1 | PLP-dependent aminotransferase family protein | - |
| QDW92_RS12980 (2630130) | 2630130..2630546 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QDW92_RS12985 (2630592) | 2630592..2630768 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QDW92_RS12990 (2630990) | 2630990..2631220 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| QDW92_RS12995 (2631312) | 2631312..2633273 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QDW92_RS13000 (2633346) | 2633346..2633882 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
| QDW92_RS13005 (2633974) | 2633974..2635145 | + | 1172 | Protein_2547 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T277762 WP_063085535.1 NZ_CP122719:c2630768-2630592 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277762 WP_001270286.1 NZ_CP122719:c2630546-2630130 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|