Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 909644..910298 | Replicon | chromosome |
Accession | NZ_CP122719 | ||
Organism | Escherichia coli strain ETEC1748 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QDW92_RS04380 | Protein ID | WP_000244781.1 |
Coordinates | 909891..910298 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QDW92_RS04375 | Protein ID | WP_000354046.1 |
Coordinates | 909644..909910 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW92_RS04355 (905732) | 905732..907165 | - | 1434 | WP_063085817.1 | 6-phospho-beta-glucosidase BglA | - |
QDW92_RS04360 (907210) | 907210..907521 | + | 312 | WP_001182952.1 | N(4)-acetylcytidine aminohydrolase | - |
QDW92_RS04365 (907685) | 907685..908344 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
QDW92_RS04370 (908421) | 908421..909401 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
QDW92_RS04375 (909644) | 909644..909910 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QDW92_RS04380 (909891) | 909891..910298 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QDW92_RS04385 (910338) | 910338..910859 | - | 522 | WP_001055888.1 | flavodoxin FldB | - |
QDW92_RS04390 (910971) | 910971..911867 | + | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
QDW92_RS04395 (911892) | 911892..912602 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QDW92_RS04400 (912608) | 912608..914341 | + | 1734 | WP_000813177.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T277753 WP_000244781.1 NZ_CP122719:909891-910298 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|