Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 826967..827802 Replicon chromosome
Accession NZ_CP122719
Organism Escherichia coli strain ETEC1748

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QDW92_RS03935 Protein ID WP_000854821.1
Coordinates 826967..827344 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag QDW92_RS03940 Protein ID WP_001285610.1
Coordinates 827434..827802 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW92_RS03905 (822094) 822094..823242 - 1149 WP_000905931.1 capsule polysaccharide export inner-membrane protein KpsE -
QDW92_RS03910 (823314) 823314..824297 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
QDW92_RS03915 (825108) 825108..825278 - 171 Protein_767 IS110 family transposase -
QDW92_RS03920 (825621) 825621..826463 - 843 WP_001280493.1 DUF4942 domain-containing protein -
QDW92_RS03925 (826548) 826548..826745 - 198 WP_085949090.1 DUF957 domain-containing protein -
QDW92_RS03930 (826773) 826773..826970 - 198 Protein_770 DUF5983 family protein -
QDW92_RS03935 (826967) 826967..827344 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW92_RS03940 (827434) 827434..827802 - 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW92_RS03945 (827882) 827882..828103 - 222 WP_000692350.1 DUF987 domain-containing protein -
QDW92_RS03950 (828190) 828190..828261 - 72 Protein_774 hypothetical protein -
QDW92_RS03955 (828350) 828350..828522 + 173 Protein_775 Hha/YmoA family nucleoid-associated regulatory protein -
QDW92_RS03960 (828841) 828841..829038 - 198 WP_032240437.1 hypothetical protein -
QDW92_RS03965 (829242) 829242..829810 + 569 Protein_777 inovirus Gp2 family protein -
QDW92_RS03970 (829976) 829976..830359 + 384 WP_000271026.1 putative zinc ribbon protein -
QDW92_RS03975 (830373) 830373..831569 - 1197 WP_001372615.1 IS110-like element ISEc20 family transposase -
QDW92_RS03980 (832131) 832131..832688 + 558 WP_000736772.1 Ail/Lom family outer membrane beta-barrel protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 830373..831569 1196


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T277752 WP_000854821.1 NZ_CP122719:c827344-826967 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT277752 WP_001285610.1 NZ_CP122719:c827802-827434 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References