Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapB(antitoxin)
Location 5408..5982 Replicon plasmid unnamed6
Accession NZ_CP122718
Organism Escherichia coli strain ETEC1749

Toxin (Protein)


Gene name vapC Uniprot ID A0A3A6SGD2
Locus tag QDX02_RS28125 Protein ID WP_000604346.1
Coordinates 5408..5782 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A3A6S782
Locus tag QDX02_RS28130 Protein ID WP_001261052.1
Coordinates 5779..5982 (-) Length 68 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX02_RS28110 (QDX02_28110) 3319..3861 + 543 WP_001005723.1 hypothetical protein -
QDX02_RS28115 (QDX02_28115) 4276..4585 + 310 Protein_2 transposase -
QDX02_RS28120 (QDX02_28120) 4669..5226 + 558 WP_000735639.1 Ail/Lom family outer membrane beta-barrel protein -
QDX02_RS28125 (QDX02_28125) 5408..5782 - 375 WP_000604346.1 PIN domain-containing protein Toxin
QDX02_RS28130 (QDX02_28130) 5779..5982 - 204 WP_001261052.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDX02_RS28135 (QDX02_28135) 6086..8098 - 2013 WP_000635641.1 relaxase/mobilization nuclease domain-containing protein -
QDX02_RS28140 (QDX02_28140) 8104..8439 - 336 WP_000045231.1 plasmid mobilization protein MobA -
QDX02_RS28145 (QDX02_28145) 8709..9023 + 315 WP_000741300.1 hypothetical protein -
QDX02_RS28150 (QDX02_28150) 9640..9810 + 171 WP_071881852.1 helix-turn-helix domain-containing protein -
QDX02_RS28155 (QDX02_28155) 9855..10491 - 637 Protein_10 DUF4942 domain-containing protein -
QDX02_RS28160 (QDX02_28160) 10546..10803 - 258 WP_000174705.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD / hlyB / hlyA / hlyC 1..68092 68092
- flank IS/Tn - - 4276..4428 152


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-114)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-44)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13911.31 Da        Isoelectric Point: 6.9672

>T277750 WP_000604346.1 NZ_CP122718:c5782-5408 [Escherichia coli]
MILVDTSVWVDHFKNKNDTLIQLLQSDFVLMHPMILAEIACGTPPAPRQRTLSDLDLLPKSHQATITEVLAFIENEKLFG
LGCGLVDITLLASTRITPGAKIWTLDKRLSRLAKHLNVEYQPVH

Download         Length: 375 bp

Antitoxin


Download         Length: 68 a.a.        Molecular weight: 7366.47 Da        Isoelectric Point: 6.2644

>AT277750 WP_001261052.1 NZ_CP122718:c5982-5779 [Escherichia coli]
MRTTVTIDDVLYAQALEMADPGMDKSDIFREAVKTFIRVQAAKRLASLGGAAPNMEITPRRRGDVAE

Download         Length: 204 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3A6SGD2

Antitoxin

Source ID Structure
AlphaFold DB A0A3A6S782

References