Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 50902..51437 Replicon plasmid unnamed5
Accession NZ_CP122717
Organism Escherichia coli strain ETEC1749

Toxin (Protein)


Gene name relE Uniprot ID Q60228
Locus tag QDX02_RS27770 Protein ID WP_001270417.1
Coordinates 50902..51189 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag QDX02_RS27775 Protein ID WP_001132895.1
Coordinates 51186..51437 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX02_RS27740 (46447) 46447..46556 + 110 Protein_50 IS5/IS1182 family transposase -
QDX02_RS27745 (47079) 47079..47329 + 251 Protein_51 type II toxin-antitoxin system ParD family antitoxin -
QDX02_RS27750 (47316) 47316..47610 + 295 Protein_52 type II toxin-antitoxin system RelE/ParE family toxin -
QDX02_RS27755 (47973) 47973..48713 + 741 WP_001066942.1 tyrosine-type recombinase/integrase -
QDX02_RS27760 (48998) 48998..49975 - 978 WP_000361610.1 RepB family plasmid replication initiator protein -
QDX02_RS27765 (50655) 50655..50900 - 246 Protein_55 integrase core domain-containing protein -
QDX02_RS27770 (50902) 50902..51189 - 288 WP_001270417.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDX02_RS27775 (51186) 51186..51437 - 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDX02_RS27780 (51610) 51610..51822 - 213 WP_000402944.1 hypothetical protein -
QDX02_RS27785 (52196) 52196..53401 + 1206 WP_000817634.1 AAA family ATPase -
QDX02_RS27790 (53398) 53398..54360 + 963 WP_000756327.1 ParB family protein -
QDX02_RS27795 (54594) 54594..55371 + 778 Protein_61 transposase DNA-binding-containing protein -
QDX02_RS27800 (55501) 55501..55584 - 84 Protein_62 DUF4113 domain-containing protein -
QDX02_RS27805 (55586) 55586..56114 + 529 Protein_63 DUF1281 domain-containing protein -
QDX02_RS27810 (56111) 56111..56422 + 312 WP_001309256.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltB / eltA 1..96635 96635


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11214.24 Da        Isoelectric Point: 10.4703

>T277746 WP_001270417.1 NZ_CP122717:c51189-50902 [Escherichia coli]
MRYQVKFREDALKEWQKLDKAIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDEQLIIAVVAVGK
RERSDVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT277746 WP_001132895.1 NZ_CP122717:c51437-51186 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T8BSB4

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References