Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 18976..19523 Replicon plasmid unnamed5
Accession NZ_CP122717
Organism Escherichia coli strain ETEC1749

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag QDX02_RS27575 Protein ID WP_001384452.1
Coordinates 19245..19523 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A2I6FMZ7
Locus tag QDX02_RS27570 Protein ID WP_000079930.1
Coordinates 18976..19245 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX02_RS27540 (14089) 14089..14400 - 312 WP_000765906.1 hypothetical protein -
- (14696) 14696..14757 - 62 NuclAT_1 - -
- (14696) 14696..14757 - 62 NuclAT_1 - -
- (14696) 14696..14757 - 62 NuclAT_1 - -
- (14696) 14696..14757 - 62 NuclAT_1 - -
QDX02_RS27550 (16060) 16060..16200 + 141 WP_064717426.1 Hok/Gef family protein -
QDX02_RS27555 (16480) 16480..16737 + 258 WP_000083834.1 replication regulatory protein RepA -
QDX02_RS27560 (16971) 16971..17045 + 75 WP_032319616.1 RepA leader peptide Tap -
QDX02_RS27565 (17038) 17038..18060 + 1023 WP_000840938.1 plasmid replication initiator RepA -
QDX02_RS27570 (18976) 18976..19245 + 270 WP_000079930.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDX02_RS27575 (19245) 19245..19523 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
QDX02_RS27580 (19569) 19569..20298 + 730 Protein_18 3'-5' exonuclease -
QDX02_RS27585 (20305) 20305..20613 - 309 Protein_19 integrase core domain-containing protein -
QDX02_RS27590 (20630) 20630..21706 - 1077 WP_000907656.1 IS110-like element ISEc21 family transposase -
QDX02_RS27595 (21988) 21988..22832 - 845 Protein_21 IS3 family transposase -
QDX02_RS27600 (22959) 22959..23353 - 395 Protein_22 ATP-binding protein -
QDX02_RS27605 (23701) 23701..24075 - 375 WP_015675362.1 heat-labile enterotoxin LT subunit B -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltB / eltA 1..96635 96635
- inside IScluster/Tn - eltB / eltA 14834..44231 29397


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T277745 WP_001384452.1 NZ_CP122717:19245-19523 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2055

>AT277745 WP_000079930.1 NZ_CP122717:18976-19245 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVADK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A2I6FMZ7

References