Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2691414..2691940 | Replicon | chromosome |
| Accession | NZ_CP122712 | ||
| Organism | Escherichia coli strain ETEC1749 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | QDX02_RS13540 | Protein ID | WP_000323025.1 |
| Coordinates | 2691414..2691701 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | QDX02_RS13545 | Protein ID | WP_000534858.1 |
| Coordinates | 2691701..2691940 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX02_RS13490 (2686438) | 2686438..2686653 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| QDX02_RS13495 (2686873) | 2686873..2687043 | + | 171 | WP_001405948.1 | putative zinc-binding protein YnfU | - |
| QDX02_RS13500 (2687407) | 2687407..2687622 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| QDX02_RS13505 (2687923) | 2687923..2688135 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| QDX02_RS13510 (2688190) | 2688190..2688279 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| QDX02_RS13515 (2688557) | 2688557..2689309 | - | 753 | WP_001047136.1 | antitermination protein | - |
| QDX02_RS13520 (2689323) | 2689323..2690372 | - | 1050 | WP_001424248.1 | DUF968 domain-containing protein | - |
| QDX02_RS13525 (2690374) | 2690374..2690652 | - | 279 | WP_012304870.1 | hypothetical protein | - |
| QDX02_RS13530 (2690719) | 2690719..2690970 | - | 252 | WP_000980994.1 | protein Rem | - |
| QDX02_RS13535 (2691187) | 2691187..2691342 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| QDX02_RS13540 (2691414) | 2691414..2691701 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| QDX02_RS13545 (2691701) | 2691701..2691940 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| QDX02_RS13550 (2691965) | 2691965..2692270 | + | 306 | WP_001326990.1 | protein YdfV | - |
| QDX02_RS13555 (2692473) | 2692473..2692805 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| QDX02_RS13560 (2693242) | 2693242..2693391 | - | 150 | WP_011443592.1 | protein YdfW | - |
| QDX02_RS13565 (2693512) | 2693512..2694534 | - | 1023 | Protein_2659 | ISNCY family transposase | - |
| QDX02_RS13570 (2695324) | 2695324..2695611 | - | 288 | Protein_2660 | hypothetical protein | - |
| QDX02_RS13575 (2696089) | 2696089..2696578 | - | 490 | Protein_2661 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2655921..2705177 | 49256 | |
| - | inside | Prophage | - | - | 2633474..2709083 | 75609 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T277732 WP_000323025.1 NZ_CP122712:c2691701-2691414 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|