Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2471586..2472224 | Replicon | chromosome |
| Accession | NZ_CP122712 | ||
| Organism | Escherichia coli strain ETEC1749 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | QDX02_RS12415 | Protein ID | WP_000813794.1 |
| Coordinates | 2471586..2471762 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QDX02_RS12420 | Protein ID | WP_001270286.1 |
| Coordinates | 2471808..2472224 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX02_RS12395 (2467205) | 2467205..2468380 | - | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
| QDX02_RS12400 (2468472) | 2468472..2469008 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| QDX02_RS12405 (2469081) | 2469081..2471042 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QDX02_RS12410 (2471134) | 2471134..2471364 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| QDX02_RS12415 (2471586) | 2471586..2471762 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QDX02_RS12420 (2471808) | 2471808..2472224 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QDX02_RS12425 (2472303) | 2472303..2473712 | + | 1410 | WP_000760625.1 | PLP-dependent aminotransferase family protein | - |
| QDX02_RS12430 (2473954) | 2473954..2475099 | + | 1146 | WP_000047429.1 | ABC transporter substrate-binding protein | - |
| QDX02_RS12435 (2475117) | 2475117..2476130 | + | 1014 | WP_000220393.1 | ABC transporter ATP-binding protein | - |
| QDX02_RS12440 (2476131) | 2476131..2477072 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T277730 WP_000813794.1 NZ_CP122712:2471586-2471762 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277730 WP_001270286.1 NZ_CP122712:2471808-2472224 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|