Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 872276..872859 | Replicon | chromosome |
| Accession | NZ_CP122712 | ||
| Organism | Escherichia coli strain ETEC1749 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | QDX02_RS04275 | Protein ID | WP_000254738.1 |
| Coordinates | 872276..872611 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | QDX02_RS04280 | Protein ID | WP_000581937.1 |
| Coordinates | 872611..872859 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX02_RS04260 (868163) | 868163..869461 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| QDX02_RS04265 (869549) | 869549..871186 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| QDX02_RS04270 (871414) | 871414..872205 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| QDX02_RS04275 (872276) | 872276..872611 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| QDX02_RS04280 (872611) | 872611..872859 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QDX02_RS04285 (872937) | 872937..875171 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| QDX02_RS04290 (875219) | 875219..876520 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T277719 WP_000254738.1 NZ_CP122712:c872611-872276 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|