Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 37498..38045 Replicon plasmid unnamed1
Accession NZ_CP122686
Organism Escherichia coli strain ETEC4067

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag QDX30_RS25260 Protein ID WP_244461648.1
Coordinates 37767..38045 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A2H4TKA5
Locus tag QDX30_RS25255 Protein ID WP_000079937.1
Coordinates 37498..37767 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX30_RS25215 (32711) 32711..32785 + 75 WP_001365705.1 RepA leader peptide Tap -
QDX30_RS25220 (32778) 32778..33635 + 858 WP_282843146.1 incFII family plasmid replication initiator RepA -
QDX30_RS25225 (34548) 34548..34817 + 270 WP_001395444.1 type II toxin-antitoxin system antitoxin YacA -
QDX30_RS25230 (34817) 34817..34927 + 111 Protein_38 type II toxin-antitoxin system toxin YacB -
QDX30_RS25235 (35026) 35026..35349 + 324 WP_282843136.1 hypothetical protein -
QDX30_RS25240 (35530) 35530..36717 - 1188 WP_086186060.1 IS91-like element IS91 family transposase -
QDX30_RS25245 (36717) 36717..37082 - 366 WP_000124096.1 hypothetical protein -
QDX30_RS25250 (37101) 37101..37322 + 222 WP_282843137.1 hypothetical protein -
QDX30_RS25255 (37498) 37498..37767 + 270 WP_000079937.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDX30_RS25260 (37767) 37767..38045 + 279 WP_244461648.1 type II toxin-antitoxin system toxin YacB Toxin
QDX30_RS25265 (38354) 38354..39496 + 1143 WP_158649904.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
QDX30_RS25270 (39469) 39469..39573 + 105 Protein_46 hypothetical protein -
QDX30_RS25275 (39585) 39585..39890 + 306 WP_000482654.1 hypothetical protein -
QDX30_RS25285 (41056) 41056..41637 + 582 WP_282843138.1 hypothetical protein -
QDX30_RS25290 (42257) 42257..42592 - 336 WP_001340323.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..67634 67634
- inside IScluster/Tn - - 35530..40581 5051


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10732.29 Da        Isoelectric Point: 8.4615

>T277712 WP_244461648.1 NZ_CP122686:37767-38045 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLTAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10174.56 Da        Isoelectric Point: 10.1760

>AT277712 WP_000079937.1 NZ_CP122686:37498-37767 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLKHGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2H4TKA5

References