Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3339319..3340024 | Replicon | chromosome |
| Accession | NZ_CP122685 | ||
| Organism | Escherichia coli strain ETEC4067 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3A6SJV3 |
| Locus tag | QDX30_RS16620 | Protein ID | WP_063085620.1 |
| Coordinates | 3339319..3339705 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QDX30_RS16625 | Protein ID | WP_001280945.1 |
| Coordinates | 3339695..3340024 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX30_RS16600 (3335323) | 3335323..3335949 | + | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
| QDX30_RS16605 (3335946) | 3335946..3337061 | - | 1116 | WP_063085618.1 | aldose sugar dehydrogenase YliI | - |
| QDX30_RS16610 (3337172) | 3337172..3337555 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| QDX30_RS16615 (3337768) | 3337768..3339093 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| QDX30_RS16620 (3339319) | 3339319..3339705 | + | 387 | WP_063085620.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QDX30_RS16625 (3339695) | 3339695..3340024 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| QDX30_RS16630 (3340094) | 3340094..3341422 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
| QDX30_RS16635 (3341430) | 3341430..3343778 | - | 2349 | WP_021523051.1 | EAL domain-containing protein | - |
| QDX30_RS16640 (3343956) | 3343956..3344867 | - | 912 | WP_001236019.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14280.45 Da Isoelectric Point: 9.9296
>T277705 WP_063085620.1 NZ_CP122685:3339319-3339705 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|