Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3067385..3068219 | Replicon | chromosome |
| Accession | NZ_CP122685 | ||
| Organism | Escherichia coli strain ETEC4067 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3S7R4W2 |
| Locus tag | QDX30_RS15290 | Protein ID | WP_063085447.1 |
| Coordinates | 3067385..3067762 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2J4HRK6 |
| Locus tag | QDX30_RS15295 | Protein ID | WP_001354276.1 |
| Coordinates | 3067851..3068219 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX30_RS15250 (3062768) | 3062768..3063601 | + | 834 | WP_001189321.1 | curli production assembly/transport protein CsgG | - |
| QDX30_RS15255 (3063666) | 3063666..3064157 | - | 492 | WP_032140678.1 | DUF1097 domain-containing protein | - |
| QDX30_RS15260 (3064259) | 3064259..3064813 | - | 555 | WP_063085449.1 | molecular chaperone YcdY | - |
| QDX30_RS15265 (3064837) | 3064837..3065574 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| QDX30_RS15270 (3065629) | 3065629..3066567 | - | 939 | WP_001357083.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QDX30_RS15280 (3067038) | 3067038..3067280 | - | 243 | WP_242378885.1 | DUF4942 domain-containing protein | - |
| QDX30_RS15285 (3067260) | 3067260..3067388 | - | 129 | Protein_2994 | DUF5983 family protein | - |
| QDX30_RS15290 (3067385) | 3067385..3067762 | - | 378 | WP_063085447.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDX30_RS15295 (3067851) | 3067851..3068219 | - | 369 | WP_001354276.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QDX30_RS15300 (3068476) | 3068476..3068772 | - | 297 | Protein_2997 | antirestriction protein | - |
| QDX30_RS15305 (3068741) | 3068741..3069613 | - | 873 | Protein_2998 | AIDA repeat-containing protein | - |
| QDX30_RS15310 (3069986) | 3069986..3070858 | - | 873 | WP_053271975.1 | GTPase family protein | - |
| QDX30_RS15315 (3071122) | 3071122..3072678 | + | 1557 | WP_086186061.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13908.94 Da Isoelectric Point: 8.5222
>T277704 WP_063085447.1 NZ_CP122685:c3067762-3067385 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13649.47 Da Isoelectric Point: 7.0261
>AT277704 WP_001354276.1 NZ_CP122685:c3068219-3067851 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S7R4W2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4HRK6 |