Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2608361..2608999 | Replicon | chromosome |
Accession | NZ_CP122685 | ||
Organism | Escherichia coli strain ETEC4067 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
Locus tag | QDX30_RS12845 | Protein ID | WP_063085535.1 |
Coordinates | 2608823..2608999 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDX30_RS12840 | Protein ID | WP_001270286.1 |
Coordinates | 2608361..2608777 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX30_RS12815 (2603409) | 2603409..2603528 | - | 120 | Protein_2508 | ABC transporter permease | - |
QDX30_RS12820 (2603501) | 2603501..2604454 | - | 954 | WP_242378934.1 | ABC transporter permease | - |
QDX30_RS12825 (2604455) | 2604455..2605468 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
QDX30_RS12830 (2605486) | 2605486..2606631 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
QDX30_RS12835 (2606876) | 2606876..2608282 | - | 1407 | WP_063085536.1 | PLP-dependent aminotransferase family protein | - |
QDX30_RS12840 (2608361) | 2608361..2608777 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDX30_RS12845 (2608823) | 2608823..2608999 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDX30_RS12850 (2609221) | 2609221..2609451 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDX30_RS12855 (2609543) | 2609543..2611504 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDX30_RS12860 (2611577) | 2611577..2612113 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
QDX30_RS12865 (2612205) | 2612205..2613376 | + | 1172 | Protein_2518 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T277703 WP_063085535.1 NZ_CP122685:c2608999-2608823 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277703 WP_001270286.1 NZ_CP122685:c2608777-2608361 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|