Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 827189..828024 Replicon chromosome
Accession NZ_CP122685
Organism Escherichia coli strain ETEC4067

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QDX30_RS03935 Protein ID WP_000854821.1
Coordinates 827189..827566 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag QDX30_RS03940 Protein ID WP_001285610.1
Coordinates 827656..828024 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX30_RS03905 (822316) 822316..823464 - 1149 WP_000905931.1 capsule polysaccharide export inner-membrane protein KpsE -
QDX30_RS03910 (823536) 823536..824519 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
QDX30_RS03915 (825330) 825330..825500 - 171 Protein_767 IS110 family transposase -
QDX30_RS03920 (825843) 825843..826685 - 843 WP_001280493.1 DUF4942 domain-containing protein -
QDX30_RS03925 (826770) 826770..826967 - 198 WP_085949090.1 DUF957 domain-containing protein -
QDX30_RS03930 (826995) 826995..827192 - 198 Protein_770 DUF5983 family protein -
QDX30_RS03935 (827189) 827189..827566 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDX30_RS03940 (827656) 827656..828024 - 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDX30_RS03945 (828104) 828104..828325 - 222 WP_000692350.1 DUF987 domain-containing protein -
QDX30_RS03950 (828412) 828412..828483 - 72 Protein_774 hypothetical protein -
QDX30_RS03955 (828572) 828572..828744 + 173 Protein_775 Hha/YmoA family nucleoid-associated regulatory protein -
QDX30_RS03960 (829063) 829063..829260 - 198 WP_032240437.1 hypothetical protein -
QDX30_RS03965 (829464) 829464..830033 + 570 WP_000220729.1 inovirus Gp2 family protein -
QDX30_RS03970 (830199) 830199..830582 + 384 WP_000271026.1 putative zinc ribbon protein -
QDX30_RS03975 (830596) 830596..831792 - 1197 WP_001372615.1 IS110-like element ISEc20 family transposase -
QDX30_RS03980 (832354) 832354..832911 + 558 WP_000736772.1 Ail/Lom family outer membrane beta-barrel protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 830596..831792 1196


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T277693 WP_000854821.1 NZ_CP122685:c827566-827189 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT277693 WP_001285610.1 NZ_CP122685:c828024-827656 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References