Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3715077..3715695 | Replicon | chromosome |
| Accession | NZ_CP122681 | ||
| Organism | Escherichia coli strain ETEC4068 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QDW67_RS18220 | Protein ID | WP_001291435.1 |
| Coordinates | 3715477..3715695 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QDW67_RS18215 | Protein ID | WP_000344800.1 |
| Coordinates | 3715077..3715451 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW67_RS18205 (3710166) | 3710166..3711359 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QDW67_RS18210 (3711382) | 3711382..3714531 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| QDW67_RS18215 (3715077) | 3715077..3715451 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QDW67_RS18220 (3715477) | 3715477..3715695 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QDW67_RS18225 (3715867) | 3715867..3716418 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| QDW67_RS18230 (3716534) | 3716534..3717004 | + | 471 | WP_063085325.1 | YlaC family protein | - |
| QDW67_RS18235 (3717168) | 3717168..3718718 | + | 1551 | WP_063085326.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QDW67_RS18240 (3718760) | 3718760..3719113 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QDW67_RS18250 (3719492) | 3719492..3719803 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QDW67_RS18255 (3719834) | 3719834..3720406 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277687 WP_001291435.1 NZ_CP122681:3715477-3715695 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277687 WP_000344800.1 NZ_CP122681:3715077-3715451 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |