Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3287258..3287963 | Replicon | chromosome |
| Accession | NZ_CP122681 | ||
| Organism | Escherichia coli strain ETEC4068 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3A6SJV3 |
| Locus tag | QDW67_RS16245 | Protein ID | WP_063085620.1 |
| Coordinates | 3287258..3287644 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QDW67_RS16250 | Protein ID | WP_001280945.1 |
| Coordinates | 3287634..3287963 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW67_RS16225 (3283262) | 3283262..3283888 | + | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
| QDW67_RS16230 (3283885) | 3283885..3285000 | - | 1116 | WP_063085618.1 | aldose sugar dehydrogenase YliI | - |
| QDW67_RS16235 (3285111) | 3285111..3285494 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| QDW67_RS16240 (3285707) | 3285707..3287032 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| QDW67_RS16245 (3287258) | 3287258..3287644 | + | 387 | WP_063085620.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QDW67_RS16250 (3287634) | 3287634..3287963 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| QDW67_RS16255 (3288033) | 3288033..3289361 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
| QDW67_RS16260 (3289369) | 3289369..3291717 | - | 2349 | WP_021523051.1 | EAL domain-containing protein | - |
| QDW67_RS16265 (3291895) | 3291895..3292806 | - | 912 | WP_001236019.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14280.45 Da Isoelectric Point: 9.9296
>T277686 WP_063085620.1 NZ_CP122681:3287258-3287644 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|