Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2605294..2605932 | Replicon | chromosome |
Accession | NZ_CP122681 | ||
Organism | Escherichia coli strain ETEC4068 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
Locus tag | QDW67_RS12765 | Protein ID | WP_063085535.1 |
Coordinates | 2605756..2605932 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDW67_RS12760 | Protein ID | WP_001270286.1 |
Coordinates | 2605294..2605710 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW67_RS12740 (2600446) | 2600446..2601387 | - | 942 | WP_063085538.1 | ABC transporter permease | - |
QDW67_RS12745 (2601388) | 2601388..2602401 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
QDW67_RS12750 (2602419) | 2602419..2603564 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
QDW67_RS12755 (2603809) | 2603809..2605215 | - | 1407 | WP_063085536.1 | PLP-dependent aminotransferase family protein | - |
QDW67_RS12760 (2605294) | 2605294..2605710 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDW67_RS12765 (2605756) | 2605756..2605932 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDW67_RS12770 (2606154) | 2606154..2606384 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDW67_RS12775 (2606476) | 2606476..2608437 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDW67_RS12780 (2608510) | 2608510..2609046 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
QDW67_RS12785 (2609138) | 2609138..2610309 | + | 1172 | Protein_2502 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T277684 WP_063085535.1 NZ_CP122681:c2605932-2605756 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277684 WP_001270286.1 NZ_CP122681:c2605710-2605294 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|