Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 723724..724559 | Replicon | chromosome |
| Accession | NZ_CP122681 | ||
| Organism | Escherichia coli strain ETEC4068 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1EZ92 |
| Locus tag | QDW67_RS03475 | Protein ID | WP_000854726.1 |
| Coordinates | 724182..724559 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QDW67_RS03470 | Protein ID | WP_064559964.1 |
| Coordinates | 723724..724092 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW67_RS03435 (718901) | 718901..719773 | + | 873 | WP_096098506.1 | GTPase family protein | - |
| QDW67_RS03440 (720146) | 720146..721243 | + | 1098 | Protein_673 | AIDA repeat-containing protein | - |
| QDW67_RS03445 (721313) | 721313..721654 | + | 342 | Protein_674 | DUF932 domain-containing protein | - |
| QDW67_RS03450 (721745) | 721745..722230 | + | 486 | WP_096098508.1 | antirestriction protein | - |
| QDW67_RS03455 (722245) | 722245..722721 | + | 477 | WP_140431832.1 | RadC family protein | - |
| QDW67_RS03460 (722790) | 722790..723011 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| QDW67_RS03465 (723030) | 723030..723674 | + | 645 | WP_016240659.1 | hypothetical protein | - |
| QDW67_RS03470 (723724) | 723724..724092 | + | 369 | WP_064559964.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW67_RS03475 (724182) | 724182..724559 | + | 378 | WP_000854726.1 | TA system toxin CbtA family protein | Toxin |
| QDW67_RS03480 (724556) | 724556..725044 | + | 489 | WP_063080559.1 | DUF5983 family protein | - |
| QDW67_RS03485 (725056) | 725056..725253 | + | 198 | WP_063080560.1 | DUF957 domain-containing protein | - |
| QDW67_RS03490 (725338) | 725338..726183 | + | 846 | WP_049038750.1 | DUF4942 domain-containing protein | - |
| QDW67_RS03500 (726471) | 726471..726977 | + | 507 | WP_063086280.1 | G/U mismatch-specific DNA glycosylase | - |
| QDW67_RS03505 (727056) | 727056..728897 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14164.10 Da Isoelectric Point: 7.8045
>T277675 WP_000854726.1 NZ_CP122681:724182-724559 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|