Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 154236..154848 | Replicon | chromosome |
| Accession | NZ_CP122681 | ||
| Organism | Escherichia coli strain ETEC4068 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | QDW67_RS00690 | Protein ID | WP_000833473.1 |
| Coordinates | 154236..154421 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A1V3VHB3 |
| Locus tag | QDW67_RS00695 | Protein ID | WP_000499746.1 |
| Coordinates | 154438..154848 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW67_RS00675 (149755) | 149755..151146 | + | 1392 | WP_063084986.1 | L-seryl-tRNA(Sec) selenium transferase | - |
| QDW67_RS00680 (151143) | 151143..152993 | + | 1851 | WP_096098561.1 | selenocysteine-specific translation elongation factor | - |
| QDW67_RS00685 (153022) | 153022..153719 | + | 698 | WP_236281370.1 | IS1 family transposase | - |
| QDW67_RS00690 (154236) | 154236..154421 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QDW67_RS00695 (154438) | 154438..154848 | + | 411 | WP_000499746.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QDW67_RS00700 (154920) | 154920..156884 | - | 1965 | WP_096098550.1 | glycoside hydrolase family 127 protein | - |
| QDW67_RS00705 (156895) | 156895..158295 | - | 1401 | WP_096098549.1 | MFS transporter | - |
| QDW67_RS00710 (158521) | 158521..159336 | + | 816 | WP_000891838.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T277673 WP_000833473.1 NZ_CP122681:154236-154421 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15290.22 Da Isoelectric Point: 4.5486
>AT277673 WP_000499746.1 NZ_CP122681:154438-154848 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9YXE2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1V3VHB3 |