Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3739959..3740577 | Replicon | chromosome |
| Accession | NZ_CP122679 | ||
| Organism | Escherichia coli strain ETEC4069 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QDW53_RS18535 | Protein ID | WP_001291435.1 |
| Coordinates | 3740359..3740577 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QDW53_RS18530 | Protein ID | WP_000344800.1 |
| Coordinates | 3739959..3740333 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW53_RS18520 (3735048) | 3735048..3736241 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QDW53_RS18525 (3736264) | 3736264..3739413 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| QDW53_RS18530 (3739959) | 3739959..3740333 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QDW53_RS18535 (3740359) | 3740359..3740577 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QDW53_RS18540 (3740749) | 3740749..3741300 | + | 552 | WP_063118620.1 | maltose O-acetyltransferase | - |
| QDW53_RS18545 (3741416) | 3741416..3741886 | + | 471 | WP_063085325.1 | YlaC family protein | - |
| QDW53_RS18550 (3742050) | 3742050..3743600 | + | 1551 | WP_063085326.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QDW53_RS18555 (3743642) | 3743642..3743995 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QDW53_RS18565 (3744374) | 3744374..3744685 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QDW53_RS18570 (3744716) | 3744716..3745288 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277666 WP_001291435.1 NZ_CP122679:3740359-3740577 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277666 WP_000344800.1 NZ_CP122679:3739959-3740333 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |