Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2599293..2599931 | Replicon | chromosome |
| Accession | NZ_CP122679 | ||
| Organism | Escherichia coli strain ETEC4069 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
| Locus tag | QDW53_RS12900 | Protein ID | WP_063085535.1 |
| Coordinates | 2599755..2599931 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QDW53_RS12895 | Protein ID | WP_001270286.1 |
| Coordinates | 2599293..2599709 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW53_RS12870 (2594341) | 2594341..2594460 | - | 120 | Protein_2521 | ABC transporter permease | - |
| QDW53_RS12875 (2594433) | 2594433..2595386 | - | 954 | WP_242378934.1 | ABC transporter permease | - |
| QDW53_RS12880 (2595387) | 2595387..2596400 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
| QDW53_RS12885 (2596418) | 2596418..2597563 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
| QDW53_RS12890 (2597808) | 2597808..2599214 | - | 1407 | WP_063085536.1 | PLP-dependent aminotransferase family protein | - |
| QDW53_RS12895 (2599293) | 2599293..2599709 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QDW53_RS12900 (2599755) | 2599755..2599931 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QDW53_RS12905 (2600153) | 2600153..2600383 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| QDW53_RS12910 (2600475) | 2600475..2602436 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QDW53_RS12915 (2602509) | 2602509..2603045 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
| QDW53_RS12920 (2603137) | 2603137..2604308 | + | 1172 | Protein_2531 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T277663 WP_063085535.1 NZ_CP122679:c2599931-2599755 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277663 WP_001270286.1 NZ_CP122679:c2599709-2599293 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|