Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 909869..910523 | Replicon | chromosome |
| Accession | NZ_CP122679 | ||
| Organism | Escherichia coli strain ETEC4069 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | QDW53_RS04380 | Protein ID | WP_000244781.1 |
| Coordinates | 910116..910523 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QDW53_RS04375 | Protein ID | WP_000354046.1 |
| Coordinates | 909869..910135 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW53_RS04355 (905957) | 905957..907390 | - | 1434 | WP_063085817.1 | 6-phospho-beta-glucosidase BglA | - |
| QDW53_RS04360 (907435) | 907435..907746 | + | 312 | WP_001182952.1 | N(4)-acetylcytidine aminohydrolase | - |
| QDW53_RS04365 (907910) | 907910..908569 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| QDW53_RS04370 (908646) | 908646..909626 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| QDW53_RS04375 (909869) | 909869..910135 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QDW53_RS04380 (910116) | 910116..910523 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| QDW53_RS04385 (910563) | 910563..911084 | - | 522 | WP_001055888.1 | flavodoxin FldB | - |
| QDW53_RS04390 (911196) | 911196..912092 | + | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
| QDW53_RS04395 (912117) | 912117..912827 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QDW53_RS04400 (912833) | 912833..914566 | + | 1734 | WP_000813177.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T277654 WP_000244781.1 NZ_CP122679:910116-910523 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|