Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3780057..3780675 | Replicon | chromosome |
Accession | NZ_CP122676 | ||
Organism | Escherichia coli strain ETEC4070 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDW57_RS18675 | Protein ID | WP_001291435.1 |
Coordinates | 3780457..3780675 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDW57_RS18670 | Protein ID | WP_000344800.1 |
Coordinates | 3780057..3780431 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW57_RS18660 (3775146) | 3775146..3776339 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDW57_RS18665 (3776362) | 3776362..3779511 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
QDW57_RS18670 (3780057) | 3780057..3780431 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDW57_RS18675 (3780457) | 3780457..3780675 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDW57_RS18680 (3780847) | 3780847..3781398 | + | 552 | WP_063118620.1 | maltose O-acetyltransferase | - |
QDW57_RS18685 (3781514) | 3781514..3781984 | + | 471 | WP_063085325.1 | YlaC family protein | - |
QDW57_RS18690 (3782148) | 3782148..3783698 | + | 1551 | WP_063085326.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDW57_RS18695 (3783740) | 3783740..3784093 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDW57_RS18705 (3784472) | 3784472..3784783 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDW57_RS18710 (3784814) | 3784814..3785386 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277641 WP_001291435.1 NZ_CP122676:3780457-3780675 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277641 WP_000344800.1 NZ_CP122676:3780057-3780431 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |