Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2617081..2617719 | Replicon | chromosome |
| Accession | NZ_CP122676 | ||
| Organism | Escherichia coli strain ETEC4070 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
| Locus tag | QDW57_RS12895 | Protein ID | WP_063085535.1 |
| Coordinates | 2617543..2617719 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QDW57_RS12890 | Protein ID | WP_001270286.1 |
| Coordinates | 2617081..2617497 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW57_RS12865 (2612129) | 2612129..2612248 | - | 120 | Protein_2518 | ABC transporter permease | - |
| QDW57_RS12870 (2612221) | 2612221..2613174 | - | 954 | WP_242378934.1 | ABC transporter permease | - |
| QDW57_RS12875 (2613175) | 2613175..2614188 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
| QDW57_RS12880 (2614206) | 2614206..2615351 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
| QDW57_RS12885 (2615596) | 2615596..2617002 | - | 1407 | WP_063085536.1 | PLP-dependent aminotransferase family protein | - |
| QDW57_RS12890 (2617081) | 2617081..2617497 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QDW57_RS12895 (2617543) | 2617543..2617719 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QDW57_RS12900 (2617941) | 2617941..2618171 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| QDW57_RS12905 (2618263) | 2618263..2620224 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QDW57_RS12910 (2620297) | 2620297..2620833 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
| QDW57_RS12915 (2620925) | 2620925..2622096 | + | 1172 | Protein_2528 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T277638 WP_063085535.1 NZ_CP122676:c2617719-2617543 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277638 WP_001270286.1 NZ_CP122676:c2617497-2617081 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|