Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 828739..829574 Replicon chromosome
Accession NZ_CP122676
Organism Escherichia coli strain ETEC4070

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QDW57_RS03950 Protein ID WP_000854821.1
Coordinates 828739..829116 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag QDW57_RS03955 Protein ID WP_001285610.1
Coordinates 829206..829574 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW57_RS03920 (823866) 823866..825014 - 1149 WP_000905931.1 capsule polysaccharide export inner-membrane protein KpsE -
QDW57_RS03925 (825086) 825086..826069 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
QDW57_RS03930 (826880) 826880..827050 - 171 Protein_770 IS110 family transposase -
QDW57_RS03935 (827393) 827393..828235 - 843 WP_001280493.1 DUF4942 domain-containing protein -
QDW57_RS03940 (828320) 828320..828517 - 198 WP_085949090.1 DUF957 domain-containing protein -
QDW57_RS03945 (828545) 828545..828742 - 198 Protein_773 DUF5983 family protein -
QDW57_RS03950 (828739) 828739..829116 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW57_RS03955 (829206) 829206..829574 - 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW57_RS03960 (829654) 829654..829875 - 222 WP_000692350.1 DUF987 domain-containing protein -
QDW57_RS03965 (829962) 829962..830033 - 72 Protein_777 hypothetical protein -
QDW57_RS03970 (830122) 830122..830294 + 173 Protein_778 Hha/YmoA family nucleoid-associated regulatory protein -
QDW57_RS03975 (830613) 830613..830810 - 198 WP_032240437.1 hypothetical protein -
QDW57_RS03980 (831014) 831014..831583 + 570 WP_000220729.1 inovirus Gp2 family protein -
QDW57_RS03985 (831749) 831749..832132 + 384 WP_000271026.1 putative zinc ribbon protein -
QDW57_RS03990 (832146) 832146..833342 - 1197 WP_001372615.1 IS110-like element ISEc20 family transposase -
QDW57_RS03995 (833904) 833904..834461 + 558 WP_000736772.1 Ail/Lom family outer membrane beta-barrel protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 832146..833342 1196


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T277628 WP_000854821.1 NZ_CP122676:c829116-828739 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT277628 WP_001285610.1 NZ_CP122676:c829574-829206 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References