Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4549548..4550383 | Replicon | chromosome |
Accession | NZ_CP122673 | ||
Organism | Escherichia coli strain ETEC4071 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A3A6S2N5 |
Locus tag | QDW56_RS22440 | Protein ID | WP_000854800.1 |
Coordinates | 4550006..4550383 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A3Z2YIX3 |
Locus tag | QDW56_RS22435 | Protein ID | WP_032178229.1 |
Coordinates | 4549548..4549916 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW56_RS22410 (4546659) | 4546659..4547477 | + | 819 | WP_001234392.1 | DUF932 domain-containing protein | - |
QDW56_RS22415 (4547569) | 4547569..4548054 | + | 486 | WP_000213706.1 | antirestriction protein | - |
QDW56_RS22420 (4548069) | 4548069..4548545 | + | 477 | WP_001186784.1 | RadC family protein | - |
QDW56_RS22425 (4548614) | 4548614..4548835 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
QDW56_RS22430 (4548854) | 4548854..4549498 | + | 645 | WP_000086748.1 | hypothetical protein | - |
QDW56_RS22435 (4549548) | 4549548..4549916 | + | 369 | WP_032178229.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDW56_RS22440 (4550006) | 4550006..4550383 | + | 378 | WP_000854800.1 | TA system toxin CbtA family protein | Toxin |
QDW56_RS22445 (4550380) | 4550380..4550868 | + | 489 | WP_000779171.1 | DUF5983 family protein | - |
QDW56_RS22450 (4550880) | 4550880..4551077 | + | 198 | WP_001374283.1 | DUF957 domain-containing protein | - |
QDW56_RS22455 (4551162) | 4551162..4552004 | + | 843 | WP_063086391.1 | DUF4942 domain-containing protein | - |
QDW56_RS22460 (4552753) | 4552753..4554291 | + | 1539 | WP_001187196.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4522838..4562104 | 39266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14068.13 Da Isoelectric Point: 9.1376
>T277621 WP_000854800.1 NZ_CP122673:4550006-4550383 [Escherichia coli]
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13823.58 Da Isoelectric Point: 6.3177
>AT277621 WP_032178229.1 NZ_CP122673:4549548-4549916 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6S2N5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z2YIX3 |