Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3780059..3780677 | Replicon | chromosome |
| Accession | NZ_CP122673 | ||
| Organism | Escherichia coli strain ETEC4071 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QDW56_RS18680 | Protein ID | WP_001291435.1 |
| Coordinates | 3780459..3780677 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QDW56_RS18675 | Protein ID | WP_000344800.1 |
| Coordinates | 3780059..3780433 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW56_RS18665 (3775148) | 3775148..3776341 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QDW56_RS18670 (3776364) | 3776364..3779513 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| QDW56_RS18675 (3780059) | 3780059..3780433 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QDW56_RS18680 (3780459) | 3780459..3780677 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QDW56_RS18685 (3780849) | 3780849..3781400 | + | 552 | WP_063118620.1 | maltose O-acetyltransferase | - |
| QDW56_RS18690 (3781516) | 3781516..3781986 | + | 471 | WP_063085325.1 | YlaC family protein | - |
| QDW56_RS18695 (3782150) | 3782150..3783700 | + | 1551 | WP_063085326.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QDW56_RS18700 (3783742) | 3783742..3784095 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QDW56_RS18710 (3784474) | 3784474..3784785 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QDW56_RS18715 (3784816) | 3784816..3785388 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277617 WP_001291435.1 NZ_CP122673:3780459-3780677 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277617 WP_000344800.1 NZ_CP122673:3780059-3780433 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |