Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3348047..3348752 | Replicon | chromosome |
Accession | NZ_CP122673 | ||
Organism | Escherichia coli strain ETEC4071 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3A6SJV3 |
Locus tag | QDW56_RS16660 | Protein ID | WP_063085620.1 |
Coordinates | 3348047..3348433 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QDW56_RS16665 | Protein ID | WP_001280945.1 |
Coordinates | 3348423..3348752 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW56_RS16640 (3344051) | 3344051..3344677 | + | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
QDW56_RS16645 (3344674) | 3344674..3345789 | - | 1116 | WP_063085618.1 | aldose sugar dehydrogenase YliI | - |
QDW56_RS16650 (3345900) | 3345900..3346283 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
QDW56_RS16655 (3346496) | 3346496..3347821 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
QDW56_RS16660 (3348047) | 3348047..3348433 | + | 387 | WP_063085620.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QDW56_RS16665 (3348423) | 3348423..3348752 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
QDW56_RS16670 (3348822) | 3348822..3350150 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
QDW56_RS16675 (3350158) | 3350158..3352506 | - | 2349 | WP_021523051.1 | EAL domain-containing protein | - |
QDW56_RS16680 (3352684) | 3352684..3353595 | - | 912 | WP_001236019.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14280.45 Da Isoelectric Point: 9.9296
>T277616 WP_063085620.1 NZ_CP122673:3348047-3348433 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|