Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 828740..829575 | Replicon | chromosome |
| Accession | NZ_CP122673 | ||
| Organism | Escherichia coli strain ETEC4071 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | QDW56_RS03950 | Protein ID | WP_000854821.1 |
| Coordinates | 828740..829117 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | QDW56_RS03955 | Protein ID | WP_001285610.1 |
| Coordinates | 829207..829575 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW56_RS03920 (823867) | 823867..825015 | - | 1149 | WP_000905931.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| QDW56_RS03925 (825087) | 825087..826070 | - | 984 | WP_001298261.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| QDW56_RS03930 (826881) | 826881..827051 | - | 171 | Protein_770 | IS110 family transposase | - |
| QDW56_RS03935 (827394) | 827394..828236 | - | 843 | WP_001280493.1 | DUF4942 domain-containing protein | - |
| QDW56_RS03940 (828321) | 828321..828518 | - | 198 | WP_085949090.1 | DUF957 domain-containing protein | - |
| QDW56_RS03945 (828546) | 828546..828743 | - | 198 | Protein_773 | DUF5983 family protein | - |
| QDW56_RS03950 (828740) | 828740..829117 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDW56_RS03955 (829207) | 829207..829575 | - | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW56_RS03960 (829655) | 829655..829876 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| QDW56_RS03965 (829963) | 829963..830034 | - | 72 | Protein_777 | hypothetical protein | - |
| QDW56_RS03970 (830123) | 830123..830295 | + | 173 | Protein_778 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| QDW56_RS03975 (830614) | 830614..830811 | - | 198 | WP_032240437.1 | hypothetical protein | - |
| QDW56_RS03980 (831015) | 831015..831584 | + | 570 | WP_000220729.1 | inovirus Gp2 family protein | - |
| QDW56_RS03985 (831750) | 831750..832133 | + | 384 | WP_000271026.1 | putative zinc ribbon protein | - |
| QDW56_RS03990 (832147) | 832147..833343 | - | 1197 | WP_001372615.1 | IS110-like element ISEc20 family transposase | - |
| QDW56_RS03995 (833905) | 833905..834462 | + | 558 | WP_000736772.1 | Ail/Lom family outer membrane beta-barrel protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 832147..833343 | 1196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T277604 WP_000854821.1 NZ_CP122673:c829117-828740 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13606.39 Da Isoelectric Point: 6.0618
>AT277604 WP_001285610.1 NZ_CP122673:c829575-829207 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|