Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 828740..829575 Replicon chromosome
Accession NZ_CP122673
Organism Escherichia coli strain ETEC4071

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QDW56_RS03950 Protein ID WP_000854821.1
Coordinates 828740..829117 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag QDW56_RS03955 Protein ID WP_001285610.1
Coordinates 829207..829575 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW56_RS03920 (823867) 823867..825015 - 1149 WP_000905931.1 capsule polysaccharide export inner-membrane protein KpsE -
QDW56_RS03925 (825087) 825087..826070 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
QDW56_RS03930 (826881) 826881..827051 - 171 Protein_770 IS110 family transposase -
QDW56_RS03935 (827394) 827394..828236 - 843 WP_001280493.1 DUF4942 domain-containing protein -
QDW56_RS03940 (828321) 828321..828518 - 198 WP_085949090.1 DUF957 domain-containing protein -
QDW56_RS03945 (828546) 828546..828743 - 198 Protein_773 DUF5983 family protein -
QDW56_RS03950 (828740) 828740..829117 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW56_RS03955 (829207) 829207..829575 - 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW56_RS03960 (829655) 829655..829876 - 222 WP_000692350.1 DUF987 domain-containing protein -
QDW56_RS03965 (829963) 829963..830034 - 72 Protein_777 hypothetical protein -
QDW56_RS03970 (830123) 830123..830295 + 173 Protein_778 Hha/YmoA family nucleoid-associated regulatory protein -
QDW56_RS03975 (830614) 830614..830811 - 198 WP_032240437.1 hypothetical protein -
QDW56_RS03980 (831015) 831015..831584 + 570 WP_000220729.1 inovirus Gp2 family protein -
QDW56_RS03985 (831750) 831750..832133 + 384 WP_000271026.1 putative zinc ribbon protein -
QDW56_RS03990 (832147) 832147..833343 - 1197 WP_001372615.1 IS110-like element ISEc20 family transposase -
QDW56_RS03995 (833905) 833905..834462 + 558 WP_000736772.1 Ail/Lom family outer membrane beta-barrel protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 832147..833343 1196


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T277604 WP_000854821.1 NZ_CP122673:c829117-828740 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT277604 WP_001285610.1 NZ_CP122673:c829575-829207 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References