Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 21313..21914 | Replicon | plasmid unnamed4 |
Accession | NZ_CP122664 | ||
Organism | Escherichia coli strain ETEC4073 |
Toxin (Protein)
Gene name | doc | Uniprot ID | U9YA20 |
Locus tag | QDY26_RS25015 | Protein ID | WP_001216045.1 |
Coordinates | 21313..21693 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QDY26_RS25020 | Protein ID | WP_001190712.1 |
Coordinates | 21693..21914 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY26_RS24985 (QDY26_24985) | 16440..16670 | - | 231 | Protein_14 | ash family protein | - |
QDY26_RS24990 (QDY26_24990) | 16754..18196 | - | 1443 | WP_236495866.1 | terminase | - |
QDY26_RS24995 (QDY26_24995) | 18238..19431 | - | 1194 | WP_000219618.1 | hypothetical protein | - |
QDY26_RS25000 (QDY26_25000) | 19517..19969 | - | 453 | WP_032192895.1 | Late promoter-activating protein | - |
QDY26_RS25005 (QDY26_25005) | 20058..21101 | - | 1044 | WP_046788789.1 | DUF968 domain-containing protein | - |
QDY26_RS25010 (QDY26_25010) | 21129..21308 | - | 180 | WP_000113018.1 | hypothetical protein | - |
QDY26_RS25015 (QDY26_25015) | 21313..21693 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QDY26_RS25020 (QDY26_25020) | 21693..21914 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QDY26_RS25025 (QDY26_25025) | 22097..23653 | + | 1557 | WP_046788805.1 | type I restriction-modification system subunit M | - |
QDY26_RS25030 (QDY26_25030) | 23650..24843 | + | 1194 | WP_077788586.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..67952 | 67952 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T277601 WP_001216045.1 NZ_CP122664:c21693-21313 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLP7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |