277600

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 21599..22092 Replicon plasmid unnamed3
Accession NZ_CP122663
Organism Escherichia coli strain ETEC4073

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag QDY26_RS24685 Protein ID WP_001230709.1
Coordinates 21838..22092 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag QDY26_RS24680 Protein ID WP_000151456.1
Coordinates 21599..21841 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY26_RS24635 (QDY26_24635) 16890..17597 + 708 WP_021503228.1 hypothetical protein -
QDY26_RS24640 (QDY26_24640) 17617..17748 + 132 Protein_14 hypothetical protein -
QDY26_RS24645 (QDY26_24645) 18072..18269 + 198 WP_001439049.1 hypothetical protein -
QDY26_RS24650 (QDY26_24650) 18271..18480 + 210 WP_000951714.1 hypothetical protein -
QDY26_RS24655 (QDY26_24655) 18477..18803 + 327 WP_000206697.1 hypothetical protein -
QDY26_RS24660 (QDY26_24660) 18934..19371 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
QDY26_RS24665 (QDY26_24665) 19396..19578 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
QDY26_RS24670 (QDY26_24670) 19875..20318 + 444 WP_000192625.1 hypothetical protein -
QDY26_RS24675 (QDY26_24675) 20735..21028 - 294 WP_000673428.1 hypothetical protein -
QDY26_RS24680 (QDY26_24680) 21599..21841 - 243 WP_000151456.1 hypothetical protein Antitoxin
QDY26_RS24685 (QDY26_24685) 21838..22092 - 255 WP_001230709.1 hypothetical protein Toxin
QDY26_RS24690 (QDY26_24690) 22089..22631 - 543 WP_001083904.1 hypothetical protein -
QDY26_RS24695 (QDY26_24695) 22735..23250 - 516 WP_001025393.1 J domain-containing protein -
QDY26_RS24700 (QDY26_24700) 23654..23983 - 330 WP_000855119.1 hypothetical protein -
QDY26_RS24705 (QDY26_24705) 24571..25236 + 666 WP_000532149.1 division plane positioning ATPase MipZ -
QDY26_RS24710 (QDY26_24710) 25310..25594 + 285 WP_001162371.1 hypothetical protein -
QDY26_RS24715 (QDY26_24715) 25612..26208 - 597 WP_000125165.1 ProQ/FINO family protein -
QDY26_RS24720 (QDY26_24720) 26358..26480 - 123 WP_223685802.1 Hok/Gef family protein -
QDY26_RS24725 (QDY26_24725) 26425..26577 - 153 Protein_31 DUF5431 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..58798 58798
- flank IS/Tn - - 26842..27990 1148


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T277600 WP_001230709.1 NZ_CP122663:c22092-21838 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT277600 WP_000151456.1 NZ_CP122663:c21841-21599 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References