277594

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 7668..8166 Replicon plasmid unnamed1
Accession NZ_CP122661
Organism Escherichia coli strain ETEC4073

Toxin (Protein)


Gene name TsxA Uniprot ID A0A764VNK7
Locus tag QDY26_RS23545 Protein ID WP_000868275.1
Coordinates 7900..8166 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID A0A3H7VMJ5
Locus tag QDY26_RS23540 Protein ID WP_001450803.1
Coordinates 7668..7910 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY26_RS23505 (QDY26_23505) 3211..3576 + 366 WP_000124098.1 hypothetical protein -
QDY26_RS23510 (QDY26_23510) 3576..4763 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDY26_RS23515 (QDY26_23515) 4887..5573 + 687 WP_236495928.1 hypothetical protein -
QDY26_RS23520 (QDY26_23520) 5602..6039 - 438 WP_000466317.1 type II toxin-antitoxin system HicB family antitoxin -
QDY26_RS23525 (QDY26_23525) 6064..6246 - 183 WP_000833471.1 type II toxin-antitoxin system HicA family toxin -
QDY26_RS23530 (QDY26_23530) 6442..6720 - 279 WP_000545935.1 cobalamin biosynthesis protein CbiX -
QDY26_RS23535 (QDY26_23535) 7046..7228 - 183 WP_000449470.1 hypothetical protein -
QDY26_RS23540 (QDY26_23540) 7668..7910 - 243 WP_001450803.1 hypothetical protein Antitoxin
QDY26_RS23545 (QDY26_23545) 7900..8166 - 267 WP_000868275.1 hypothetical protein Toxin
QDY26_RS23550 (QDY26_23550) 8217..8441 - 225 WP_000749827.1 hypothetical protein -
QDY26_RS23555 (QDY26_23555) 8537..8761 - 225 WP_112842838.1 hypothetical protein -
QDY26_RS23560 (QDY26_23560) 8803..9057 - 255 WP_236495927.1 hypothetical protein -
QDY26_RS23565 (QDY26_23565) 9166..9531 + 366 WP_000124098.1 hypothetical protein -
QDY26_RS23570 (QDY26_23570) 9531..10718 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDY26_RS23575 (QDY26_23575) 10907..11218 + 312 Protein_20 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyD / hlyB / hlyB / hlyA / hlyC 1..95540 95540
- inside IScluster/Tn - - 1141..11218 10077


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10199.63 Da        Isoelectric Point: 9.5657

>T277594 WP_000868275.1 NZ_CP122661:c8166-7900 [Escherichia coli]
MKVRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVITVADLIFHEDAFDTIDFTRGGLRENDKEVVSMMIQEMN
NEREKNVN

Download         Length: 267 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9288.69 Da        Isoelectric Point: 9.7120

>AT277594 WP_001450803.1 NZ_CP122661:c7910-7668 [Escherichia coli]
MLTENTPENIKRLRQKIGLTQRECAEIFSMNPRTWRRKEEPAGTASGTALTPVEFKYLQLLAGEHPEYVLRKRDKPKCSE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A764VNK7

Antitoxin

Source ID Structure
AlphaFold DB A0A3H7VMJ5

References