Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 5602..6246 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122661 | ||
| Organism | Escherichia coli strain ETEC4073 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7L6LII1 |
| Locus tag | QDY26_RS23525 | Protein ID | WP_000833471.1 |
| Coordinates | 6064..6246 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A7L6LHN8 |
| Locus tag | QDY26_RS23520 | Protein ID | WP_000466317.1 |
| Coordinates | 5602..6039 (-) | Length | 146 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY26_RS23480 (QDY26_23480) | 1037..1144 | + | 108 | Protein_1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDY26_RS23485 (QDY26_23485) | 1141..1491 | + | 351 | WP_236495944.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDY26_RS23490 (QDY26_23490) | 1522..1683 | + | 162 | Protein_3 | IS66 family transposase | - |
| QDY26_RS23495 (QDY26_23495) | 1772..2137 | + | 366 | WP_000124098.1 | hypothetical protein | - |
| QDY26_RS23500 (QDY26_23500) | 2137..3123 | + | 987 | Protein_5 | IS91-like element IS91 family transposase | - |
| QDY26_RS23505 (QDY26_23505) | 3211..3576 | + | 366 | WP_000124098.1 | hypothetical protein | - |
| QDY26_RS23510 (QDY26_23510) | 3576..4763 | + | 1188 | WP_000937614.1 | IS91-like element IS91 family transposase | - |
| QDY26_RS23515 (QDY26_23515) | 4887..5573 | + | 687 | WP_236495928.1 | hypothetical protein | - |
| QDY26_RS23520 (QDY26_23520) | 5602..6039 | - | 438 | WP_000466317.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QDY26_RS23525 (QDY26_23525) | 6064..6246 | - | 183 | WP_000833471.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QDY26_RS23530 (QDY26_23530) | 6442..6720 | - | 279 | WP_000545935.1 | cobalamin biosynthesis protein CbiX | - |
| QDY26_RS23535 (QDY26_23535) | 7046..7228 | - | 183 | WP_000449470.1 | hypothetical protein | - |
| QDY26_RS23540 (QDY26_23540) | 7668..7910 | - | 243 | WP_001450803.1 | hypothetical protein | - |
| QDY26_RS23545 (QDY26_23545) | 7900..8166 | - | 267 | WP_000868275.1 | hypothetical protein | - |
| QDY26_RS23550 (QDY26_23550) | 8217..8441 | - | 225 | WP_000749827.1 | hypothetical protein | - |
| QDY26_RS23555 (QDY26_23555) | 8537..8761 | - | 225 | WP_112842838.1 | hypothetical protein | - |
| QDY26_RS23560 (QDY26_23560) | 8803..9057 | - | 255 | WP_236495927.1 | hypothetical protein | - |
| QDY26_RS23565 (QDY26_23565) | 9166..9531 | + | 366 | WP_000124098.1 | hypothetical protein | - |
| QDY26_RS23570 (QDY26_23570) | 9531..10718 | + | 1188 | WP_000937614.1 | IS91-like element IS91 family transposase | - |
| QDY26_RS23575 (QDY26_23575) | 10907..11218 | + | 312 | Protein_20 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyD / hlyB / hlyB / hlyA / hlyC | 1..95540 | 95540 | |
| - | inside | IScluster/Tn | - | - | 1141..11218 | 10077 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6675.97 Da Isoelectric Point: 11.0013
>T277593 WP_000833471.1 NZ_CP122661:c6246-6064 [Escherichia coli]
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
Download Length: 183 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 16227.10 Da Isoelectric Point: 4.3135
>AT277593 WP_000466317.1 NZ_CP122661:c6039-5602 [Escherichia coli]
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LII1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LHN8 |