Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2813841..2814676 | Replicon | chromosome |
| Accession | NZ_CP122660 | ||
| Organism | Escherichia coli strain ETEC4073 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J5ZPW7 |
| Locus tag | QDY26_RS13930 | Protein ID | WP_000854722.1 |
| Coordinates | 2813841..2814218 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0K4A940 |
| Locus tag | QDY26_RS13935 | Protein ID | WP_001285576.1 |
| Coordinates | 2814308..2814676 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY26_RS13895 (2809433) | 2809433..2809987 | - | 555 | WP_001001921.1 | molecular chaperone YcdY | - |
| QDY26_RS13900 (2810011) | 2810011..2810748 | - | 738 | WP_000283667.1 | zinc-binding phosphatase | - |
| QDY26_RS13905 (2810803) | 2810803..2811741 | - | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QDY26_RS13915 (2812212) | 2812212..2813054 | - | 843 | WP_236495822.1 | DUF4942 domain-containing protein | - |
| QDY26_RS13920 (2813139) | 2813139..2813336 | - | 198 | WP_000445281.1 | DUF957 domain-containing protein | - |
| QDY26_RS13925 (2813356) | 2813356..2813844 | - | 489 | WP_000761669.1 | DUF5983 family protein | - |
| QDY26_RS13930 (2813841) | 2813841..2814218 | - | 378 | WP_000854722.1 | TA system toxin CbtA family protein | Toxin |
| QDY26_RS13935 (2814308) | 2814308..2814676 | - | 369 | WP_001285576.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDY26_RS13940 (2814756) | 2814756..2814977 | - | 222 | WP_089570377.1 | DUF987 domain-containing protein | - |
| QDY26_RS13945 (2815040) | 2815040..2815516 | - | 477 | WP_001186747.1 | RadC family protein | - |
| QDY26_RS13950 (2815532) | 2815532..2816014 | - | 483 | WP_169029783.1 | antirestriction protein | - |
| QDY26_RS13955 (2816106) | 2816106..2816924 | - | 819 | WP_024220054.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | csgB / csgD / csgE / csgF / csgG | 2805220..2835157 | 29937 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14103.15 Da Isoelectric Point: 8.2904
>T277587 WP_000854722.1 NZ_CP122660:c2814218-2813841 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13599.36 Da Isoelectric Point: 6.3159
>AT277587 WP_001285576.1 NZ_CP122660:c2814676-2814308 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J5ZPW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K4A940 |