Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1018218..1018801 | Replicon | chromosome |
Accession | NZ_CP122660 | ||
Organism | Escherichia coli strain ETEC4073 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | QDY26_RS04985 | Protein ID | WP_000254738.1 |
Coordinates | 1018466..1018801 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QDY26_RS04980 | Protein ID | WP_000581937.1 |
Coordinates | 1018218..1018466 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY26_RS04970 (1014557) | 1014557..1015858 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QDY26_RS04975 (1015906) | 1015906..1018140 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QDY26_RS04980 (1018218) | 1018218..1018466 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QDY26_RS04985 (1018466) | 1018466..1018801 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
QDY26_RS04990 (1018872) | 1018872..1019663 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QDY26_RS04995 (1019891) | 1019891..1021528 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QDY26_RS05000 (1021616) | 1021616..1022914 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T277578 WP_000254738.1 NZ_CP122660:1018466-1018801 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|