Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3622262..3622880 | Replicon | chromosome |
Accession | NZ_CP122655 | ||
Organism | Escherichia coli strain ETEC4074 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDW60_RS18110 | Protein ID | WP_001291435.1 |
Coordinates | 3622662..3622880 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDW60_RS18105 | Protein ID | WP_000344800.1 |
Coordinates | 3622262..3622636 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW60_RS18095 (3617351) | 3617351..3618544 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDW60_RS18100 (3618567) | 3618567..3621716 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QDW60_RS18105 (3622262) | 3622262..3622636 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDW60_RS18110 (3622662) | 3622662..3622880 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDW60_RS18115 (3623052) | 3623052..3623603 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QDW60_RS18120 (3623719) | 3623719..3624189 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QDW60_RS18125 (3624353) | 3624353..3625903 | + | 1551 | WP_032083478.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDW60_RS18130 (3625945) | 3625945..3626298 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDW60_RS18140 (3626677) | 3626677..3626988 | + | 312 | WP_032083470.1 | MGMT family protein | - |
QDW60_RS18145 (3627019) | 3627019..3627591 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277566 WP_001291435.1 NZ_CP122655:3622662-3622880 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277566 WP_000344800.1 NZ_CP122655:3622262-3622636 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |