Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2231342..2231868 | Replicon | chromosome |
Accession | NZ_CP122655 | ||
Organism | Escherichia coli strain ETEC4074 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | QDW60_RS11030 | Protein ID | WP_000323025.1 |
Coordinates | 2231342..2231629 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | QDW60_RS11035 | Protein ID | WP_000534858.1 |
Coordinates | 2231629..2231868 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW60_RS10980 (2226366) | 2226366..2226581 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
QDW60_RS10985 (2226801) | 2226801..2226971 | + | 171 | WP_001405948.1 | putative zinc-binding protein YnfU | - |
QDW60_RS10990 (2227335) | 2227335..2227550 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
QDW60_RS10995 (2227851) | 2227851..2228063 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
QDW60_RS11000 (2228118) | 2228118..2228207 | + | 90 | WP_120795389.1 | hypothetical protein | - |
QDW60_RS11005 (2228485) | 2228485..2229237 | - | 753 | WP_001047135.1 | antitermination protein | - |
QDW60_RS11010 (2229251) | 2229251..2230300 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
QDW60_RS11015 (2230302) | 2230302..2230580 | - | 279 | WP_012304870.1 | hypothetical protein | - |
QDW60_RS11020 (2230647) | 2230647..2230898 | - | 252 | WP_000980994.1 | protein Rem | - |
QDW60_RS11025 (2231115) | 2231115..2231270 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
QDW60_RS11030 (2231342) | 2231342..2231629 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
QDW60_RS11035 (2231629) | 2231629..2231868 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
QDW60_RS11040 (2231893) | 2231893..2232198 | + | 306 | WP_001326990.1 | protein YdfV | - |
QDW60_RS11045 (2232401) | 2232401..2232733 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
QDW60_RS11050 (2233170) | 2233170..2233319 | - | 150 | WP_180302674.1 | protein YdfW | - |
QDW60_RS11055 (2233440) | 2233440..2234489 | - | 1050 | Protein_2161 | IS1202-like element ISEsa1 family transposase | - |
QDW60_RS11060 (2234544) | 2234544..2234963 | - | 420 | WP_001151195.1 | DUF977 family protein | - |
QDW60_RS11065 (2235004) | 2235004..2235969 | - | 966 | WP_032084229.1 | phage O protein family | - |
QDW60_RS11070 (2235950) | 2235950..2236471 | - | 522 | WP_000705349.1 | toxin YdaT family protein | - |
QDW60_RS11075 (2236455) | 2236455..2236682 | - | 228 | WP_000476993.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2195185..2248709 | 53524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T277558 WP_000323025.1 NZ_CP122655:c2231629-2231342 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|