Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1011497..1012080 | Replicon | chromosome |
Accession | NZ_CP122655 | ||
Organism | Escherichia coli strain ETEC4074 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | QDW60_RS04935 | Protein ID | WP_000254738.1 |
Coordinates | 1011745..1012080 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1V2T5M9 |
Locus tag | QDW60_RS04930 | Protein ID | WP_000581941.1 |
Coordinates | 1011497..1011745 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW60_RS04920 (1007838) | 1007838..1009137 | + | 1300 | Protein_964 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QDW60_RS04925 (1009185) | 1009185..1011419 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QDW60_RS04930 (1011497) | 1011497..1011745 | + | 249 | WP_000581941.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QDW60_RS04935 (1011745) | 1011745..1012080 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
QDW60_RS04940 (1012151) | 1012151..1012942 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QDW60_RS04945 (1013170) | 1013170..1014807 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QDW60_RS04950 (1014895) | 1014895..1016193 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T277555 WP_000254738.1 NZ_CP122655:1011745-1012080 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|