Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3761515..3762133 | Replicon | chromosome |
| Accession | NZ_CP122652 | ||
| Organism | Escherichia coli strain ETEC4075 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QDW61_RS18580 | Protein ID | WP_001291435.1 |
| Coordinates | 3761915..3762133 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QDW61_RS18575 | Protein ID | WP_000344800.1 |
| Coordinates | 3761515..3761889 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW61_RS18565 (3756604) | 3756604..3757797 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QDW61_RS18570 (3757820) | 3757820..3760969 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| QDW61_RS18575 (3761515) | 3761515..3761889 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QDW61_RS18580 (3761915) | 3761915..3762133 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QDW61_RS18585 (3762305) | 3762305..3762856 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| QDW61_RS18590 (3762972) | 3762972..3763442 | + | 471 | WP_063085325.1 | YlaC family protein | - |
| QDW61_RS18595 (3763606) | 3763606..3765156 | + | 1551 | WP_063085326.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QDW61_RS18600 (3765198) | 3765198..3765551 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QDW61_RS18610 (3765930) | 3765930..3766241 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QDW61_RS18615 (3766272) | 3766272..3766844 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T277539 WP_001291435.1 NZ_CP122652:3761915-3762133 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT277539 WP_000344800.1 NZ_CP122652:3761515-3761889 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |