Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3074629..3075463 | Replicon | chromosome |
| Accession | NZ_CP122652 | ||
| Organism | Escherichia coli strain ETEC4075 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QDW61_RS15285 | Protein ID | WP_120145672.1 |
| Coordinates | 3074629..3075006 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2J4HRK6 |
| Locus tag | QDW61_RS15290 | Protein ID | WP_001354276.1 |
| Coordinates | 3075095..3075463 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW61_RS15245 (3070012) | 3070012..3070845 | + | 834 | WP_001189321.1 | curli production assembly/transport protein CsgG | - |
| QDW61_RS15250 (3070910) | 3070910..3071401 | - | 492 | WP_032140678.1 | DUF1097 domain-containing protein | - |
| QDW61_RS15255 (3071503) | 3071503..3072057 | - | 555 | WP_063085449.1 | molecular chaperone YcdY | - |
| QDW61_RS15260 (3072081) | 3072081..3072818 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| QDW61_RS15265 (3072873) | 3072873..3073811 | - | 939 | WP_001357083.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QDW61_RS15275 (3074282) | 3074282..3074524 | - | 243 | WP_242378885.1 | DUF4942 domain-containing protein | - |
| QDW61_RS15280 (3074504) | 3074504..3074632 | - | 129 | Protein_2994 | DUF5983 family protein | - |
| QDW61_RS15285 (3074629) | 3074629..3075006 | - | 378 | WP_120145672.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDW61_RS15290 (3075095) | 3075095..3075463 | - | 369 | WP_001354276.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QDW61_RS15295 (3075720) | 3075720..3076016 | - | 297 | Protein_2997 | antirestriction protein | - |
| QDW61_RS15300 (3075985) | 3075985..3076857 | - | 873 | Protein_2998 | AIDA repeat-containing protein | - |
| QDW61_RS15305 (3077230) | 3077230..3078102 | - | 873 | WP_053271975.1 | GTPase family protein | - |
| QDW61_RS15310 (3078366) | 3078366..3079151 | + | 786 | Protein_3000 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13855.89 Da Isoelectric Point: 7.8043
>T277537 WP_120145672.1 NZ_CP122652:c3075006-3074629 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTCDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTCDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13649.47 Da Isoelectric Point: 7.0261
>AT277537 WP_001354276.1 NZ_CP122652:c3075463-3075095 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|