Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2638983..2639621 | Replicon | chromosome |
Accession | NZ_CP122652 | ||
Organism | Escherichia coli strain ETEC4075 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
Locus tag | QDW61_RS13000 | Protein ID | WP_063085535.1 |
Coordinates | 2639445..2639621 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDW61_RS12995 | Protein ID | WP_001270286.1 |
Coordinates | 2638983..2639399 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW61_RS12975 (2634135) | 2634135..2635076 | - | 942 | WP_063085538.1 | ABC transporter permease | - |
QDW61_RS12980 (2635077) | 2635077..2636090 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
QDW61_RS12985 (2636108) | 2636108..2637253 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
QDW61_RS12990 (2637498) | 2637498..2638904 | - | 1407 | WP_063085536.1 | PLP-dependent aminotransferase family protein | - |
QDW61_RS12995 (2638983) | 2638983..2639399 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDW61_RS13000 (2639445) | 2639445..2639621 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDW61_RS13005 (2639843) | 2639843..2640073 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDW61_RS13010 (2640165) | 2640165..2642126 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDW61_RS13015 (2642199) | 2642199..2642735 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
QDW61_RS13020 (2642827) | 2642827..2643998 | + | 1172 | Protein_2550 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T277533 WP_063085535.1 NZ_CP122652:c2639621-2639445 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277533 WP_001270286.1 NZ_CP122652:c2639399-2638983 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|