Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 723728..724563 | Replicon | chromosome |
Accession | NZ_CP122652 | ||
Organism | Escherichia coli strain ETEC4075 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1EZ92 |
Locus tag | QDW61_RS03475 | Protein ID | WP_000854726.1 |
Coordinates | 724186..724563 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | QDW61_RS03470 | Protein ID | WP_064559964.1 |
Coordinates | 723728..724096 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW61_RS03435 (718905) | 718905..719777 | + | 873 | WP_096098506.1 | GTPase family protein | - |
QDW61_RS03440 (720150) | 720150..721247 | + | 1098 | Protein_673 | AIDA repeat-containing protein | - |
QDW61_RS03445 (721317) | 721317..721658 | + | 342 | Protein_674 | DUF932 domain-containing protein | - |
QDW61_RS03450 (721749) | 721749..722234 | + | 486 | WP_096098508.1 | antirestriction protein | - |
QDW61_RS03455 (722249) | 722249..722725 | + | 477 | WP_140431832.1 | RadC family protein | - |
QDW61_RS03460 (722794) | 722794..723015 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
QDW61_RS03465 (723034) | 723034..723678 | + | 645 | WP_016240659.1 | hypothetical protein | - |
QDW61_RS03470 (723728) | 723728..724096 | + | 369 | WP_064559964.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDW61_RS03475 (724186) | 724186..724563 | + | 378 | WP_000854726.1 | TA system toxin CbtA family protein | Toxin |
QDW61_RS03480 (724560) | 724560..725048 | + | 489 | WP_063080559.1 | DUF5983 family protein | - |
QDW61_RS03485 (725060) | 725060..725257 | + | 198 | WP_063080560.1 | DUF957 domain-containing protein | - |
QDW61_RS03490 (725342) | 725342..726187 | + | 846 | WP_049038750.1 | DUF4942 domain-containing protein | - |
QDW61_RS03500 (726475) | 726475..726981 | + | 507 | WP_063086280.1 | G/U mismatch-specific DNA glycosylase | - |
QDW61_RS03505 (727060) | 727060..728901 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14164.10 Da Isoelectric Point: 7.8045
>T277524 WP_000854726.1 NZ_CP122652:724186-724563 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|