Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PanAT/DUF4065(antitoxin)
Location 4744467..4745392 Replicon chromosome
Accession NZ_CP122648
Organism Escherichia coli strain ETEC4077

Toxin (Protein)


Gene name panT Uniprot ID -
Locus tag QDY56_RS23555 Protein ID WP_014640052.1
Coordinates 4744467..4744853 (-) Length 129 a.a.

Antitoxin (Protein)


Gene name panA Uniprot ID -
Locus tag QDY56_RS23560 Protein ID WP_024174200.1
Coordinates 4744883..4745392 (-) Length 170 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY56_RS23495 (4739571) 4739571..4740395 + 825 WP_097420368.1 DUF2303 family protein -
QDY56_RS23500 (4740524) 4740524..4741060 + 537 WP_112023950.1 5'-deoxynucleotidase -
QDY56_RS23505 (4741051) 4741051..4741413 + 363 WP_001242718.1 phage protein -
QDY56_RS23510 (4741410) 4741410..4741613 + 204 WP_000111289.1 hypothetical protein -
QDY56_RS23515 (4741606) 4741606..4741845 + 240 WP_112023949.1 hypothetical protein -
QDY56_RS23520 (4741842) 4741842..4742369 + 528 WP_075843227.1 ead/Ea22-like family protein -
QDY56_RS23525 (4742371) 4742371..4742562 + 192 WP_001014290.1 hypothetical protein -
QDY56_RS23530 (4742565) 4742565..4742879 + 315 Protein_4613 DUF551 domain-containing protein -
QDY56_RS23535 (4743126) 4743126..4743317 + 192 WP_001690200.1 DUF551 domain-containing protein -
QDY56_RS23540 (4743317) 4743317..4743889 + 573 WP_001061345.1 3'-5' exonuclease -
QDY56_RS23545 (4743926) 4743926..4744207 + 282 WP_001093917.1 pyocin activator PrtN family protein -
QDY56_RS23550 (4744254) 4744254..4744427 - 174 WP_000390072.1 hypothetical protein -
QDY56_RS23555 (4744467) 4744467..4744853 - 387 WP_014640052.1 hypothetical protein Toxin
QDY56_RS23560 (4744883) 4744883..4745392 - 510 WP_024174200.1 Panacea domain-containing protein Antitoxin
QDY56_RS23565 (4745709) 4745709..4745813 - 105 Protein_4620 tRNA-dihydrouridine synthase -
QDY56_RS23570 (4746176) 4746176..4747132 - 957 WP_063085441.1 DUF2713 family protein -
QDY56_RS23575 (4747450) 4747450..4747965 + 516 WP_001295691.1 zinc uptake transcriptional repressor Zur -
QDY56_RS23580 (4748007) 4748007..4748216 - 210 WP_001030593.1 CsbD family protein -
QDY56_RS23585 (4748332) 4748332..4749657 - 1326 WP_001545103.1 MATE family efflux transporter DinF -
QDY56_RS23590 (4749730) 4749730..4750338 - 609 WP_000646078.1 transcriptional repressor LexA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4709047..4750338 41291
- inside Prophage - - 4709047..4750816 41769


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Antitoxin SocA-like, Panacea domain

(6-116)


Sequences

Toxin        


Download         Length: 129 a.a.        Molecular weight: 14465.40 Da        Isoelectric Point: 5.4833

>T277519 WP_014640052.1 NZ_CP122648:c4744853-4744467 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE

Download         Length: 387 bp

Antitoxin


Download         Length: 170 a.a.        Molecular weight: 19559.39 Da        Isoelectric Point: 5.3338

>AT277519 WP_024174200.1 NZ_CP122648:c4745392-4744883 [Escherichia coli]
MAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYNLIETNGHDVLLRSDPREMDAD
EVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLISEGKSEDEANRIIGKMEESQK
LKEFSLQLS

Download         Length: 510 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References