Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
| Location | 4744467..4745392 | Replicon | chromosome |
| Accession | NZ_CP122648 | ||
| Organism | Escherichia coli strain ETEC4077 | ||
Toxin (Protein)
| Gene name | panT | Uniprot ID | - |
| Locus tag | QDY56_RS23555 | Protein ID | WP_014640052.1 |
| Coordinates | 4744467..4744853 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | panA | Uniprot ID | - |
| Locus tag | QDY56_RS23560 | Protein ID | WP_024174200.1 |
| Coordinates | 4744883..4745392 (-) | Length | 170 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY56_RS23495 (4739571) | 4739571..4740395 | + | 825 | WP_097420368.1 | DUF2303 family protein | - |
| QDY56_RS23500 (4740524) | 4740524..4741060 | + | 537 | WP_112023950.1 | 5'-deoxynucleotidase | - |
| QDY56_RS23505 (4741051) | 4741051..4741413 | + | 363 | WP_001242718.1 | phage protein | - |
| QDY56_RS23510 (4741410) | 4741410..4741613 | + | 204 | WP_000111289.1 | hypothetical protein | - |
| QDY56_RS23515 (4741606) | 4741606..4741845 | + | 240 | WP_112023949.1 | hypothetical protein | - |
| QDY56_RS23520 (4741842) | 4741842..4742369 | + | 528 | WP_075843227.1 | ead/Ea22-like family protein | - |
| QDY56_RS23525 (4742371) | 4742371..4742562 | + | 192 | WP_001014290.1 | hypothetical protein | - |
| QDY56_RS23530 (4742565) | 4742565..4742879 | + | 315 | Protein_4613 | DUF551 domain-containing protein | - |
| QDY56_RS23535 (4743126) | 4743126..4743317 | + | 192 | WP_001690200.1 | DUF551 domain-containing protein | - |
| QDY56_RS23540 (4743317) | 4743317..4743889 | + | 573 | WP_001061345.1 | 3'-5' exonuclease | - |
| QDY56_RS23545 (4743926) | 4743926..4744207 | + | 282 | WP_001093917.1 | pyocin activator PrtN family protein | - |
| QDY56_RS23550 (4744254) | 4744254..4744427 | - | 174 | WP_000390072.1 | hypothetical protein | - |
| QDY56_RS23555 (4744467) | 4744467..4744853 | - | 387 | WP_014640052.1 | hypothetical protein | Toxin |
| QDY56_RS23560 (4744883) | 4744883..4745392 | - | 510 | WP_024174200.1 | Panacea domain-containing protein | Antitoxin |
| QDY56_RS23565 (4745709) | 4745709..4745813 | - | 105 | Protein_4620 | tRNA-dihydrouridine synthase | - |
| QDY56_RS23570 (4746176) | 4746176..4747132 | - | 957 | WP_063085441.1 | DUF2713 family protein | - |
| QDY56_RS23575 (4747450) | 4747450..4747965 | + | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
| QDY56_RS23580 (4748007) | 4748007..4748216 | - | 210 | WP_001030593.1 | CsbD family protein | - |
| QDY56_RS23585 (4748332) | 4748332..4749657 | - | 1326 | WP_001545103.1 | MATE family efflux transporter DinF | - |
| QDY56_RS23590 (4749730) | 4749730..4750338 | - | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4709047..4750338 | 41291 | |
| - | inside | Prophage | - | - | 4709047..4750816 | 41769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14465.40 Da Isoelectric Point: 5.4833
>T277519 WP_014640052.1 NZ_CP122648:c4744853-4744467 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
Download Length: 387 bp
Antitoxin
Download Length: 170 a.a. Molecular weight: 19559.39 Da Isoelectric Point: 5.3338
>AT277519 WP_024174200.1 NZ_CP122648:c4745392-4744883 [Escherichia coli]
MAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYNLIETNGHDVLLRSDPREMDAD
EVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLISEGKSEDEANRIIGKMEESQK
LKEFSLQLS
MAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYNLIETNGHDVLLRSDPREMDAD
EVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLISEGKSEDEANRIIGKMEESQK
LKEFSLQLS
Download Length: 510 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|