Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3381591..3382296 | Replicon | chromosome |
| Accession | NZ_CP122648 | ||
| Organism | Escherichia coli strain ETEC4077 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3A6SJV3 |
| Locus tag | QDY56_RS16930 | Protein ID | WP_063085620.1 |
| Coordinates | 3381591..3381977 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QDY56_RS16935 | Protein ID | WP_001280945.1 |
| Coordinates | 3381967..3382296 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY56_RS16910 (3377595) | 3377595..3378221 | + | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
| QDY56_RS16915 (3378218) | 3378218..3379333 | - | 1116 | WP_063085618.1 | aldose sugar dehydrogenase YliI | - |
| QDY56_RS16920 (3379444) | 3379444..3379827 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| QDY56_RS16925 (3380040) | 3380040..3381365 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| QDY56_RS16930 (3381591) | 3381591..3381977 | + | 387 | WP_063085620.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QDY56_RS16935 (3381967) | 3381967..3382296 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| QDY56_RS16940 (3382366) | 3382366..3383694 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
| QDY56_RS16945 (3383702) | 3383702..3386050 | - | 2349 | WP_021523051.1 | EAL domain-containing protein | - |
| QDY56_RS16950 (3386228) | 3386228..3387139 | - | 912 | WP_001236019.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14280.45 Da Isoelectric Point: 9.9296
>T277512 WP_063085620.1 NZ_CP122648:3381591-3381977 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSTKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|