Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 915271..915925 | Replicon | chromosome |
| Accession | NZ_CP122648 | ||
| Organism | Escherichia coli strain ETEC4077 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | QDY56_RS04420 | Protein ID | WP_000244781.1 |
| Coordinates | 915518..915925 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QDY56_RS04415 | Protein ID | WP_000354046.1 |
| Coordinates | 915271..915537 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY56_RS04395 (911359) | 911359..912792 | - | 1434 | WP_063085817.1 | 6-phospho-beta-glucosidase BglA | - |
| QDY56_RS04400 (912837) | 912837..913148 | + | 312 | WP_001182952.1 | N(4)-acetylcytidine aminohydrolase | - |
| QDY56_RS04405 (913312) | 913312..913971 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| QDY56_RS04410 (914048) | 914048..915028 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| QDY56_RS04415 (915271) | 915271..915537 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QDY56_RS04420 (915518) | 915518..915925 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| QDY56_RS04425 (915965) | 915965..916486 | - | 522 | WP_001055888.1 | flavodoxin FldB | - |
| QDY56_RS04430 (916598) | 916598..917494 | + | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
| QDY56_RS04435 (917519) | 917519..918229 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QDY56_RS04440 (918235) | 918235..919968 | + | 1734 | WP_000813177.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T277501 WP_000244781.1 NZ_CP122648:915518-915925 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|