Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PanAT/DUF4065(antitoxin)
Location 4735338..4736263 Replicon chromosome
Accession NZ_CP122643
Organism Escherichia coli strain ETEC4079

Toxin (Protein)


Gene name panT Uniprot ID -
Locus tag QDW55_RS23505 Protein ID WP_014640052.1
Coordinates 4735338..4735724 (-) Length 129 a.a.

Antitoxin (Protein)


Gene name panA Uniprot ID -
Locus tag QDW55_RS23510 Protein ID WP_024174200.1
Coordinates 4735754..4736263 (-) Length 170 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW55_RS23445 (4730442) 4730442..4731266 + 825 WP_097420368.1 DUF2303 family protein -
QDW55_RS23450 (4731395) 4731395..4731931 + 537 WP_112023950.1 5'-deoxynucleotidase -
QDW55_RS23455 (4731922) 4731922..4732284 + 363 WP_001242718.1 phage protein -
QDW55_RS23460 (4732281) 4732281..4732484 + 204 WP_000111289.1 hypothetical protein -
QDW55_RS23465 (4732477) 4732477..4732716 + 240 WP_112023949.1 hypothetical protein -
QDW55_RS23470 (4732713) 4732713..4733240 + 528 WP_075843227.1 ead/Ea22-like family protein -
QDW55_RS23475 (4733242) 4733242..4733433 + 192 WP_001014290.1 hypothetical protein -
QDW55_RS23480 (4733436) 4733436..4733750 + 315 Protein_4603 DUF551 domain-containing protein -
QDW55_RS23485 (4733997) 4733997..4734188 + 192 WP_001690200.1 DUF551 domain-containing protein -
QDW55_RS23490 (4734188) 4734188..4734760 + 573 WP_001061345.1 3'-5' exonuclease -
QDW55_RS23495 (4734797) 4734797..4735078 + 282 WP_001093917.1 pyocin activator PrtN family protein -
QDW55_RS23500 (4735125) 4735125..4735298 - 174 WP_000390072.1 hypothetical protein -
QDW55_RS23505 (4735338) 4735338..4735724 - 387 WP_014640052.1 hypothetical protein Toxin
QDW55_RS23510 (4735754) 4735754..4736263 - 510 WP_024174200.1 Panacea domain-containing protein Antitoxin
QDW55_RS23515 (4736580) 4736580..4736684 - 105 Protein_4610 tRNA-dihydrouridine synthase -
QDW55_RS23520 (4737047) 4737047..4738003 - 957 WP_063085441.1 DUF2713 family protein -
QDW55_RS23525 (4738321) 4738321..4738836 + 516 WP_001295691.1 zinc uptake transcriptional repressor Zur -
QDW55_RS23530 (4738878) 4738878..4739087 - 210 WP_001030593.1 CsbD family protein -
QDW55_RS23535 (4739203) 4739203..4740528 - 1326 WP_001545103.1 MATE family efflux transporter DinF -
QDW55_RS23540 (4740601) 4740601..4741209 - 609 WP_000646078.1 transcriptional repressor LexA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4699919..4741209 41290


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Antitoxin SocA-like, Panacea domain

(6-116)


Sequences

Toxin        


Download         Length: 129 a.a.        Molecular weight: 14465.40 Da        Isoelectric Point: 5.4833

>T277494 WP_014640052.1 NZ_CP122643:c4735724-4735338 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE

Download         Length: 387 bp

Antitoxin


Download         Length: 170 a.a.        Molecular weight: 19559.39 Da        Isoelectric Point: 5.3338

>AT277494 WP_024174200.1 NZ_CP122643:c4736263-4735754 [Escherichia coli]
MAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYNLIETNGHDVLLRSDPREMDAD
EVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLISEGKSEDEANRIIGKMEESQK
LKEFSLQLS

Download         Length: 510 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References