Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2667487..2668125 | Replicon | chromosome |
Accession | NZ_CP122643 | ||
Organism | Escherichia coli strain ETEC4079 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3A6S5Q3 |
Locus tag | QDW55_RS13265 | Protein ID | WP_063085535.1 |
Coordinates | 2667949..2668125 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDW55_RS13260 | Protein ID | WP_001270286.1 |
Coordinates | 2667487..2667903 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW55_RS13235 (2662535) | 2662535..2662654 | - | 120 | Protein_2596 | ABC transporter permease | - |
QDW55_RS13240 (2662627) | 2662627..2663580 | - | 954 | WP_242378934.1 | ABC transporter permease | - |
QDW55_RS13245 (2663581) | 2663581..2664594 | - | 1014 | WP_063085537.1 | ABC transporter ATP-binding protein | - |
QDW55_RS13250 (2664612) | 2664612..2665757 | - | 1146 | WP_000047450.1 | ABC transporter substrate-binding protein | - |
QDW55_RS13255 (2666002) | 2666002..2667408 | - | 1407 | WP_063085536.1 | PLP-dependent aminotransferase family protein | - |
QDW55_RS13260 (2667487) | 2667487..2667903 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDW55_RS13265 (2667949) | 2667949..2668125 | - | 177 | WP_063085535.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDW55_RS13270 (2668347) | 2668347..2668577 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDW55_RS13275 (2668669) | 2668669..2670630 | - | 1962 | WP_063085534.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDW55_RS13280 (2670703) | 2670703..2671239 | - | 537 | WP_000429507.1 | DNA-binding transcriptional regulator SutR | - |
QDW55_RS13285 (2671331) | 2671331..2672502 | + | 1172 | Protein_2606 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T277485 WP_063085535.1 NZ_CP122643:c2668125-2667949 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPNDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT277485 WP_001270286.1 NZ_CP122643:c2667903-2667487 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|