Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 832589..833424 Replicon chromosome
Accession NZ_CP122643
Organism Escherichia coli strain ETEC4079

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QDW55_RS03975 Protein ID WP_000854821.1
Coordinates 832589..832966 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag QDW55_RS03980 Protein ID WP_001285610.1
Coordinates 833056..833424 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW55_RS03945 (827716) 827716..828864 - 1149 WP_000905931.1 capsule polysaccharide export inner-membrane protein KpsE -
QDW55_RS03950 (828936) 828936..829919 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
QDW55_RS03955 (830730) 830730..830900 - 171 Protein_775 IS110 family transposase -
QDW55_RS03960 (831243) 831243..832085 - 843 WP_001280493.1 DUF4942 domain-containing protein -
QDW55_RS03965 (832170) 832170..832367 - 198 WP_085949090.1 DUF957 domain-containing protein -
QDW55_RS03970 (832395) 832395..832592 - 198 Protein_778 DUF5983 family protein -
QDW55_RS03975 (832589) 832589..832966 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDW55_RS03980 (833056) 833056..833424 - 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDW55_RS03985 (833504) 833504..833725 - 222 WP_000692350.1 DUF987 domain-containing protein -
QDW55_RS03990 (833812) 833812..833883 - 72 Protein_782 hypothetical protein -
QDW55_RS03995 (833972) 833972..834144 + 173 Protein_783 Hha/YmoA family nucleoid-associated regulatory protein -
QDW55_RS04000 (834463) 834463..834660 - 198 WP_032240437.1 hypothetical protein -
QDW55_RS04005 (834864) 834864..835433 + 570 WP_000220729.1 inovirus Gp2 family protein -
QDW55_RS04010 (835599) 835599..835982 + 384 WP_000271026.1 putative zinc ribbon protein -
QDW55_RS04015 (835996) 835996..837192 - 1197 WP_001372615.1 IS110-like element ISEc20 family transposase -
QDW55_RS04020 (837754) 837754..838311 + 558 WP_000736772.1 Ail/Lom family outer membrane beta-barrel protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 835996..837192 1196


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T277475 WP_000854821.1 NZ_CP122643:c832966-832589 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT277475 WP_001285610.1 NZ_CP122643:c833424-833056 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References