277473

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 42760..43261 Replicon plasmid unnamed8
Accession NZ_CP122642
Organism Escherichia coli strain ETEC4085

Toxin (Protein)


Gene name TsxA Uniprot ID Q9F571
Locus tag QDW62_RS29670 Protein ID WP_000702246.1
Coordinates 43001..43261 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag QDW62_RS29665 Protein ID WP_001132407.1
Coordinates 42760..43011 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW62_RS29625 (QDW62_29625) 37955..38656 + 702 WP_000280995.1 StbB family protein -
QDW62_RS29630 (QDW62_29630) 38703..39302 + 600 WP_000091422.1 hypothetical protein -
QDW62_RS29635 (QDW62_29635) 39322..39648 + 327 WP_000206697.1 hypothetical protein -
QDW62_RS29640 (QDW62_29640) 39779..40216 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
QDW62_RS29645 (QDW62_29645) 40241..40423 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
QDW62_RS29650 (QDW62_29650) 40720..41139 + 420 WP_000068544.1 hypothetical protein -
QDW62_RS29655 (QDW62_29655) 41246..41512 - 267 WP_000681608.1 type II toxin-antitoxin system HicB family antitoxin -
QDW62_RS29660 (QDW62_29660) 41932..42210 - 279 WP_000545937.1 hypothetical protein -
QDW62_RS29665 (QDW62_29665) 42760..43011 - 252 WP_001132407.1 transcriptional regulator Antitoxin
QDW62_RS29670 (QDW62_29670) 43001..43261 - 261 WP_000702246.1 hypothetical protein Toxin
QDW62_RS29675 (QDW62_29675) 43312..43536 - 225 WP_000814384.1 hypothetical protein -
QDW62_RS29680 (QDW62_29680) 43634..43843 - 210 WP_000866037.1 hypothetical protein -
QDW62_RS29685 (QDW62_29685) 43885..44208 - 324 WP_000427402.1 hypothetical protein -
QDW62_RS29690 (QDW62_29690) 44789..45118 - 330 WP_000855118.1 hypothetical protein -
QDW62_RS29695 (QDW62_29695) 45716..46381 + 666 WP_000532148.1 division plane positioning ATPase MipZ -
QDW62_RS29700 (QDW62_29700) 46460..46744 + 285 WP_282840423.1 CopG family transcriptional regulator -
QDW62_RS29705 (QDW62_29705) 46815..47072 - 258 Protein_55 transposase zinc-binding domain-containing protein -
QDW62_RS29710 (QDW62_29710) 47347..47688 - 342 WP_023909256.1 chaperonin -
QDW62_RS29715 (QDW62_29715) 47649..48098 - 450 WP_013362817.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid erm(B) - 1..66179 66179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9891.42 Da        Isoelectric Point: 10.0665

>T277473 WP_000702246.1 NZ_CP122642:c43261-43001 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEKAFDTIDFASDGLRENDKEIIFMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT277473 WP_001132407.1 NZ_CP122642:c43011-42760 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3E1XBA7

Antitoxin

Source ID Structure

References