277466

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 21490..21955 Replicon plasmid unnamed5
Accession NZ_CP122639
Organism Escherichia coli strain ETEC4085

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag QDW62_RS28245 Protein ID WP_001230707.1
Coordinates 21490..21741 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag QDW62_RS28250 Protein ID WP_000801440.1
Coordinates 21728..21955 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW62_RS28215 (QDW62_28215) 16972..17499 - 528 WP_000577043.1 DUF2726 domain-containing protein -
QDW62_RS28220 (QDW62_28220) 17634..18038 - 405 WP_012421203.1 hypothetical protein -
QDW62_RS28225 (QDW62_28225) 18051..18287 - 237 WP_071699791.1 RepB family plasmid replication initiator protein -
QDW62_RS28230 (QDW62_28230) 18284..18916 - 633 WP_077625774.1 replication initiation protein -
QDW62_RS28235 (QDW62_28235) 20331..20846 + 516 WP_001025395.1 J domain-containing protein -
QDW62_RS28240 (QDW62_28240) 20951..21493 + 543 WP_001083906.1 hypothetical protein -
QDW62_RS28245 (QDW62_28245) 21490..21741 + 252 WP_001230707.1 hypothetical protein Toxin
QDW62_RS28250 (QDW62_28250) 21728..21955 + 228 WP_000801440.1 hypothetical protein Antitoxin
QDW62_RS28255 (QDW62_28255) 22409..22708 + 300 WP_000650309.1 hypothetical protein -
QDW62_RS28260 (QDW62_28260) 22799..23149 + 351 WP_000854259.1 hypothetical protein -
QDW62_RS28265 (QDW62_28265) 23454..23702 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
QDW62_RS28270 (QDW62_28270) 23699..24046 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
QDW62_RS28275 (QDW62_28275) 24407..24910 + 504 WP_089552162.1 relaxosome-coupling protein TaxA -
QDW62_RS28280 (QDW62_28280) 24914..26143 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
QDW62_RS28285 (QDW62_28285) 26220..26486 + 267 WP_000160396.1 hypothetical protein -
QDW62_RS28290 (QDW62_28290) 26491..26724 + 234 WP_000121161.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-2.1 - 1..36533 36533


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T277466 WP_001230707.1 NZ_CP122639:21490-21741 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT277466 WP_000801440.1 NZ_CP122639:21728-21955 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References